PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 362aa    MW: 40321.8 Da    PI: 9.7243
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22193genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.6e-52131421129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
               lppGfrFhP+d+el+++yL++kv+gk  ++  +  + +vd++kvePwdLp +++ + kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + +g+l
  EMT22193  13 LPPGFRFHPRDDELICDYLAPKVTGKVgFSGRRPpLVDVDLNKVEPWDLPVTASVGGKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR-RGAL 112
               79************************986665656***************8888899***********************************9999.999* PP

       NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
               vg++ktLvfy+grapkg+kt+Wvmheyrle
  EMT22193 113 VGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 142
               ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-542147IPR003441NAC domain
PROSITE profilePS5100550.99613221IPR003441NAC domain
PfamPF023651.7E-2614141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSMSFLSMVE TELPPGFRFH PRDDELICDY LAPKVTGKVG FSGRRPPLVD VDLNKVEPWD  60
LPVTASVGGK EWYFYSLKDR KYATGQRTNR ATVSGYWKAT GKDRVVARRG ALVGMRKTLV  120
FYQGRAPKGR KTEWVMHEYR LEGAHEQASK SHLQEEIRSW CHPQAKEPHQ HRPWHIHRHL  180
LTTTAASHGH HPSTAPGHHE HLRRRRTCQQ EDWVLCRVIC KKKSGVGATP RPRNLTNIVH  240
GTSTDTSSPP LPPLMDTTLA QLQATMNTSA AAALEQVPCF SSFSNNSASN SSYLPMVTGN  300
SNGMSYLDHG LPDFGSYLDP ALNCDKKVLK AVLSQLSSMG GEVVPSMSPQ MAAAVSSTWN  360
HF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-45914111140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7712860.0KC771286.1 Triticum aestivum cultivar Suwon11 NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577546.11e-169PREDICTED: NAC domain-containing protein 21/22-like isoform X2
TrEMBLM8BK830.0M8BK83_AEGTA; NAC domain-containing protein 21/22
STRINGMLOC_64240.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.18e-72NAC family protein